PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_172474g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family GeBP
Protein Properties Length: 455aa    MW: 50767.6 Da    PI: 6.3563
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_172474g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57367.53e-21161253397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     + ++w+ +De+++L Gl+ f  k gk   ++++ +y+++++ +++++s++q+ +K+rrLK Kf+  +++    ++ sf+++++  +++l+k +Wg
  MA_172474g0010 161 SLQVWNPKDELAFLNGLLAF-IKGGKGFPKNMSPVYDYIRDTMDIQYSNKQFRDKLRRLKAKFQSLMEN-MGVNNYSFKSTDEAAMYKLCKELWG 253
                     5689****************.667778889***************************************.889999******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.4E-19163253IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MVSADSTTEA SENYSSSEES EKMVHSRTPG PGPGHGQART PIPPPPPSGS ESDEDSDYST  60
PPPKTHQQEE QKKEQQPPPS PSPSPSSLIS NKTAATKTSV KRPREENDGT PETPSTKKKT  120
TAHTAQNSDE VPAKEKKKAQ KKNVAESIST PSSPQKSGKK SLQVWNPKDE LAFLNGLLAF  180
IKGGKGFPKN MSPVYDYIRD TMDIQYSNKQ FRDKLRRLKA KFQSLMENMG VNNYSFKSTD  240
EAAMYKLCKE LWGGEDEGDD EHRHNAETVG KASTNGKDKK KKKKLPVEAE ELDEEKTKYG  300
EDQGEEEEEG QDEPKRNKTM SNTLVKSNAG DVEQISKELY SQIREERDDM VNEVKNTVAN  360
ILKESQAKKK AMLEGYLLNT RADHVQLLYG DLMTGIHSGR RAPVLSRVKA EALEEKWRKQ  420
QIMEMKAFSA RLDLLQEECE MCLESLGEPV GSGRS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1277284DKKKKKKL
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9800912
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28040.13e-14DNA-binding storekeeper protein-related transcriptional regulator